PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011078637.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 463aa    MW: 51072 Da    PI: 7.595
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011078637.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1314.1e-41156232177
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     +C v gC++dls+ keyhrrhkvC+vhsk++ v+v+g++qrfCqqCsrfh l+efD++krsCr+rLa+hnerrrk+q
  XP_011078637.1 156 VCIVYGCNKDLSSSKEYHRRHKVCDVHSKTARVIVNGIQQRFCQQCSRFHVLTEFDDGKRSCRKRLAGHNERRRKPQ 232
                     59*************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-32151218IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.035154231IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.68E-39155236IPR004333Transcription factor, SBP-box
PfamPF031101.1E-30157230IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MESLSYPFEG RGLPFTNDVE LHIDGSRNLL KGWDAETGSV PIRDVFEIEG MGFIEPDVVS  60
PQCMENSVDN ANGVSGKSVP STSTITLEFG KRFTNSVVKT NDEKLVESGS MIENLACPRE  120
SKGIQFSVEN SISPSQGPSV SAKRARIANL QSQIPVCIVY GCNKDLSSSK EYHRRHKVCD  180
VHSKTARVIV NGIQQRFCQQ CSRFHVLTEF DDGKRSCRKR LAGHNERRRK PQFDTHFGST  240
FFGTDLSRTS LLFSKIIPNG FSGDQCNNPT HPSRHVKLEE EPSQTSQSAV PLNVNQVLPK  300
PLLRLHENGK QYPPENLLSS PLSVLELPAG TNSSSALSLL SAQSPNLLSN SGSISSDHPL  360
ILEEYHQTNL GLYQNPTKPA GKTQPKNFNP IVFSSSSDDV DQGVSFGTRS RESGLNHYHY  420
PSPSPEGANT VDLLQLSFHL QRVEQQKYSG QVKLENGSFR SPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-30152230684squamosa promoter binding protein-like 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078637.10.0PREDICTED: squamosa promoter-binding-like protein 6
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68311933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.14e-47SBP family protein